PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_3117_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HD-ZIP
Protein Properties Length: 819aa    MW: 91123.4 Da    PI: 7.979
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_3117_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.81.1e-1952107156
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    +++ +++t+ q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
  Neem_3117_f_1  52 KKRYHRHTQRQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMK 107
                    688999***********************************************998 PP

2START181.64.5e-572414591206
                    HHHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S..EEEEEEEEC CS
          START   1 elaeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla..kaetlevis 86 
                    ela +a++el+++a+a+ep+W       e++n+de+l++f+++ +      ++ea+r+s vv+m++ +lve+l+d+++    +++       +  +
  Neem_3117_f_1 241 ELAVAAMEELMRMAQAGEPLWIPGEnctEMLNEDEYLRTFPRGIGpkplgLRSEASRESSVVIMNHINLVEILMDVAK---SMVKcvLRYCFKSYD 333
                    57899*****************999999**************999********************************5...444433122334444 PP

                    TT.........EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE- CS
          START  87 sg.........galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdl 172
                    +g             l +ae+q++splvp R+ +fvRy++q+++g+w++vdvS+ds ++ p    + +++++pSg+li++++ng+skv+wvehv++
  Neem_3117_f_1 334 PGspinrsrrkLQWSLASAEFQVPSPLVPtRENYFVRYCKQHPDGTWAVVDVSLDSLRPSP----ISKCRRRPSGCLIQELPNGYSKVIWVEHVEV 425
                    44555555644888899******************************************99....689999************************* PP

                    -SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
          START 173 kgrlphwllrslvksglaegaktwvatlqrqcek 206
                    ++r++h+++r++v+ gla+gak+wvatl+rqce+
  Neem_3117_f_1 426 DDRSVHEIYRPVVNCGLAFGAKRWVATLDRQCER 459
                    ********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.9E-2237107IPR009057Homeodomain-like
SuperFamilySSF466892.97E-1938110IPR009057Homeodomain-like
PROSITE profilePS5007116.42249109IPR001356Homeobox domain
SMARTSM003898.5E-1950113IPR001356Homeobox domain
PfamPF000462.7E-1752107IPR001356Homeobox domain
CDDcd000862.08E-1852110No hitNo description
PROSITE patternPS00027084107IPR017970Homeobox, conserved site
SuperFamilySSF559616.41E-30232461No hitNo description
PROSITE profilePS5084835.703232462IPR002913START domain
CDDcd088758.07E-101236458No hitNo description
SMARTSM002342.3E-49241459IPR002913START domain
PfamPF018527.3E-47242459IPR002913START domain
Gene3DG3DSA:3.30.530.202.0E-4359458IPR023393START-like domain
SuperFamilySSF559618.8E-27479710No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 819 aa     Download sequence    Send to blast
MFESDHMFDM TSKSSESDLG KLKDDDYETK SGTETMEIPS GDDQDPSQCP KKKRYHRHTQ  60
RQIQEMEAFF KECPHPDDKQ RKELSRELGL EPLQVKFWFQ NKRTQMKAQQ ERHENQILKA  120
ENEKLRAENN RYKEALGNAT CPNCGGPAAL GEMSFDEQHL RIENARLREE IDRISAIAAK  180
YVGKPLSSFP HLSSHLPSRS LDLGFNNLGT QSGFVGEMYG GGDLIRSISG PTEADKPMIV  240
ELAVAAMEEL MRMAQAGEPL WIPGENCTEM LNEDEYLRTF PRGIGPKPLG LRSEASRESS  300
VVIMNHINLV EILMDVAKSM VKCVLRYCFK SYDPGSPINR SRRKLQWSLA SAEFQVPSPL  360
VPTRENYFVR YCKQHPDGTW AVVDVSLDSL RPSPISKCRR RPSGCLIQEL PNGYSKVIWV  420
EHVEVDDRSV HEIYRPVVNC GLAFGAKRWV ATLDRQCERL ASSMASNIPA GDLCVITSPE  480
GRKSMLKLAE RMVTSFCTGV GASTAHAWTT LSATGSDDVR VMTRKSMDDP GRPPGIVLSA  540
ATSFWIPVPP KRVFDFLRDE NSRSEWDILS NGGLVQEMAH IANGREPGNC VSLLRVNSAN  600
SSQSNMLVLQ ESCTDSTGSY VIYAPVDIVA MNMVLSGGDP DYVALLPSGF AILPDGPGLN  660
GGRILEVGSG GSLLTVAFQI LVDSVPTAKL SLGSVATVNS LIKCTVERIK AAVCNLIDID  720
EPGTNNIEKK RKKGDKKPAG IWCLRYFKKF IKRRSQERTL LDPCTLLLLC VEVVKKHFLC  780
KAKRFLYFDS QRTKRNTSLM TPIGSGEGIA KLIEITRSN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1728732KKRKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007026004.10.0Protodermal factor 2 isoform 1
RefseqXP_007026003.10.0Protodermal factor 2 isoform 1
RefseqXP_007026002.10.0Protodermal factor 2 isoform 1
SwissprotQ93V990.0PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLA0A061GGE70.0A0A061GGE7_THECC; Protodermal factor 2 isoform 1
STRINGPOPTR_0004s01980.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49128149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2